Lecsó

LecsóHungarian

Also: Lecso, Lecho, Magyar lecsó

A Hungarian braised stew of thin-walled yellow wax peppers, ripe tomatoes, and onion cooked down in lard or oil with sweet paprika until fully soft and saucy.

Identity criteria

  1. 1Hungarian wax peppers (TV paprika or lecsópaprika) are the dominant vegetable — bell peppers are not a valid substitute
  2. 2Ripe, juicy fresh tomatoes that fully dissolve into the base
  3. 3Hungarian sweet paprika (édesnemes) bloomed in hot fat is a non-negotiable seasoning, not merely a garnish
  4. 4Peppers and tomatoes are cooked until completely tender — no crunch remains
  5. 5The stew cooks in its own vegetable liquid only, never with added water
  6. 6Onion is softened in fat before any other vegetable is added

Components

Base

Hungarian yellow wax peppers (TV paprika / lecsópaprika)essentialThin-walled, mildly sweet Hungarian variety; their specific flavour and texture define the dish

Ripe fresh tomatoesessentialMust be fully ripe and juicy; they break down and form the sauce

Protein

EggsoptionalScrambled in for the tojásos lecsó variant

Kolbász (Hungarian smoked sausage)optionalSliced and rendered in the fat before the vegetables for the kolbászos variant

Aromatics

Onionessential

Fat

LardoptionalTraditional fat; sunflower oil is the accepted modern substitute

Seasoning

Hungarian sweet paprika (édesnemes)essentialBloomed in hot fat before wet ingredients are added to activate fat-soluble colour and flavour compounds

Saltessential

Technique

Sweat onion in fat before adding peppers
Builds the aromatic foundation; raw onion added simultaneously with peppers never fully softens and leaves a sharp undertone
Bloom paprika in hot fat before adding wet ingredients
Paprika's colour and flavour compounds are fat-soluble; adding it directly to liquid dulls both colour and depth
Low-and-slow braise in the vegetables' own liquid
Peppers and tomatoes release sufficient water; added liquid dilutes the concentrated sweetness that defines the dish
Maintain a gentle simmer, never a rolling boil
High heat scorches the paprika and drives off the bright pepper-tomato aroma into a coarser, browned flavour register

Form & serving

Served
Served directly from the pan, hot, as a standalone bowl or alongside a main
Temperature
hot
Portion
A generous ladle as a side; a full bowl as a light main
Pairs with
crusty white bread · fried or scrambled egg · sour cream · kolbász or debreceni sausage · roast pork

Character

Flavour

sweetbrightpaprika-warmvegetallightly acidicsavoryumami-light

Texture

Fully softened pepper pieces in a loose, saucy tomato base; uniform tenderness throughout, no crunch

Eaten

Everyday Hungarian home cooking; a summer and early-autumn staple tied to the local pepper and tomato harvest; eaten at midday or as a light evening meal, at the family table; also made in large batches and preserved in sterilised jars for winter

When

summer · early-autumn

Variations & related

Regional variations

  • Tojásos lecsó · Hungary

    Eggs cracked or beaten and stirred into the finished stew; the most common everyday version

  • Kolbászos lecsó · Hungary

    Sliced Hungarian smoked kolbász or debreceni rendered in the fat first, enriching the base with sausage fat and smokiness

  • Rizses lecsó · Hungary

    Short-grain rice added to the stew and cooked in the vegetable liquid, producing a one-pot grain dish

  • Baconos lecsó · Hungary

    Smoked bacon used as the fat base, adding a deeper smoke note

  • Yugoslav lecho · Former Yugoslavia, Serbia

    Closely related preparation; often uses red bell peppers and is made in quantity for jar preservation

Related dishes

  • sibling Pisto

    Spanish pepper-tomato-onion stew cooked in olive oil; same ingredient logic, different fat and seasoning tradition

  • sibling Ratatouille

    French Provençal braised vegetable stew; includes courgette and aubergine, lacks paprika, longer cook

  • sibling Peperonata

    Italian braised sweet pepper dish; similar technique but uses vinegar or sugar, no paprika

  • sibling Shakshuka

    North African eggs-in-tomato-pepper sauce; the egg-stirred-into-stew technique echoes tojásos lecsó

  • descendant Rizses lecsó

    One-pot grain variant built directly on the lecsó base with rice cooked in

  • pairs-with Kolbász

    Traditional accompaniment; sausage fat rendered into the stew deepens and enriches the base

Substitutions

  • Hungarian wax peppers → Italian frying peppers (friggitelli)admissible

    Closest widely available substitute; similar thin wall, mild sweetness, and texture

  • Lard → Sunflower oiladmissible

    Standard modern substitute; widely accepted and does not noticeably alter flavour

  • Fresh ripe tomatoes → Canned whole peeled tomatoesadmissible

    Acceptable out of season; drain excess liquid and reduce salt slightly

  • Hungarian wax peppers → Bell peppersinadmissible

    Breaks the dish — bell peppers are thicker-walled and sweeter in a different register; the result is a generic pepper stew, not lecsó

  • Hungarian sweet paprika → Spanish smoked paprikainadmissible

    Smoke note overwrites the clean, bright pepper identity; may be used in tiny addition alongside sweet paprika but not as a straight replacement

  • Hungarian sweet paprika → Hot paprika as the sole paprikainadmissible

    Heat dominates what should be a sweet, mild base; traditionally heat is absent or very restrained in lecsó

  • Lard → Olive oiladmissible

    Works but introduces a Mediterranean flavour note that sits outside the Hungarian taste tradition

Common mistakes

  • Substituting bell peppers for Hungarian wax peppers — the result lacks the thin-skinned meatiness and characteristic flavour and reads as a generic pepper stew
  • Adding water to speed cooking — the dish must steam in its own vegetable juices or the base becomes thin and dilute
  • Adding paprika directly to liquid rather than blooming it in hot fat first — produces dull colour and muted flavour
  • Undercooking so peppers retain crunch — lecsó is a braise; the peppers must be completely soft
  • Defaulting to hot or smoked paprika as the primary seasoning — the canonical base is mild and sweet, not spiced
  • Over-reducing the stew to a thick paste — lecsó should keep a loose, saucy consistency
  • Using unripe or watery tomatoes — the tomato must dissolve and sweeten, not stay chunky and acidic

Provenance

Lecsó is a settled Hungarian dish whose name likely derives from a South Slavic root and whose ingredient trio reflects the New World vegetables — pepper, tomato — that fully integrated into Central European cooking by the 18th century. It appears in Hungarian cookbooks by the late 19th century as a peasant and home-kitchen staple, particularly associated with the late-summer pepper harvest. Closely related preparations exist across the former Habsburg lands and the Balkans, but the Hungarian version defined by sweet paprika and yellow wax peppers is the canonical form.

References

  1. 1.Magyar culinary tradition
  2. 2.Gundel Károly: Magyar szakácskönyv
  3. 3.Magyar Elek: Az ínyesmester szakácskönyve
  4. 4.Hagyományok Ízek Régiók (HÍR) Hungarian Culinary Heritage Registry

Confidence: high

Built on these foundations

2

The base preparations this dish is assembled from — open one for its master ratio & method.